@ CHSETTINGS:J/@ /@$/@(/@,/@0/@4/@8/@xV4?0 @8@H @-D0G>8 <0< S0000b0P H@-,0<(1>0 0 b 0 H @-@d 00/0@0P/4R 4/P@-Q 0@0PR e?>/ o )0@O0@p@-@`P @P  pp@-P<, <4 /@-A V0@@- 0@B0@/@p@-`P|0|@P  @0 P@@0Pp8$ 4 2:0(0 000000pV'0@0@0@@-u 6 PP *PAP FP P Z 9 4 0 (@0S  03/ 0@V0@0@T-x0000 0T `Pp 09  04 0< 0? t)( 0& P`0 VV0 :@C0@0@0@0@0@ 0@ 0@ 0@@6 0@@-5UP005 0P 0 "0 Ѝ0N0@s@-P>Pxt@PP 0PpP T`0S  0PdP (0S |\ 0@@C0@U3 0@ 0@@-0 $ LP@-SMpP`  @$ 0@;P/0 0````W } %0@ c$  @P@$ 0@PW@$  0@P $0@@P@Ѝ @Q@-00P 0P@-P%P"P@`- 0@ P* 0-0 0 0@mP- 0@ P 0-00 0 0@YP - 0@ P @@@T@Ѝp@-3#H  34Q"H 4 R_2"l "p H T ]2"2Q0TT TX 0002 T  2@8@=?t P `\\ k&PB6H4Y(2@ , P`  ; !l! +++++!, ,3 !  ! $ !( , |!  t! p! h8A00 $(,P0TX\`004110 $$ $@$D$ # # 3   $ ( ,   PDUUD @C0@D`HH 0@@ 0@HC0@I 0@/ DD3&P; KPJa Dɳf16$?2SAPFp@-p; EP`AHQ P LTDQ0T0,A4  %P0   %P00#  %P00  %P0    %PP`00PTPPTPT0l  T0 00D0 T 0kp蠆@C0@T 0@n 0@ 0@ 0@ 0@ 0@0N0@@ 0@ 0@@-xx O%P5$ PT PO 0P ,(( 8%PA 5P 0P  0P 0-$"- P@-? 0@ P0-00? 0@ P 8P.P-n 0@HC0@ 0@PC0@0@1 0@R 0@7@-h x*P X10&46#0 #"$#< 0 P1 P P `*h@PU $P  $P0 P&0PV0 8 0S| 0000d 80@0 P&@0S@ $P(08 > 0@DC0@ 0@@C0@0@0@C0@C0@ 0@\00@-,Dē $@ T U9904,400404 4S0D`00@-@Dē@ 4T  9904@400444 0D(0 (  R( R/D0 ( ( R/Dp@-}2hTDē $"\d V99;0h40 0400400404|2\Qē $X"pD T9990400404p4S002 R`  `0Sd01d R $ 4S01 R ! 1SP01P R$l1$R $  Q/@>/@tp@-@P 0 9p!0@8@-@P@P P8P08pp@-@`P0Pp, 0+"0@D"0@V"0@6"0@a"0@7@-P@P, 0P0 S   0sPl 0   0hP @< 0   d>D"0@"0@"0@"0@@-pP@`4P 4@EP PU@@|p@-P@<`4@BPT=Pp4p蠆@-@0P@-PB04S +004P,bp0PB! 0PS SS S404j 40 4f$4p0W$4[UXS0tPM p0wPS;0404 0P=  0 P4aU0P/ (4S 0|P& @ $40"S (4S   $ 44P  08#8RD 0 $R@(0LP F-@ T P `3P 0TA@@T xP`@0pDAD ZP apDWZapDWWDP 7DP%SPT@TRPF-,AP0P#00(40C4T,T0TTT T$T8T4T84S p` 4*-PP0$R  R0x0 0$l0 $u pGWP((PC 404u `V*PrA0@ N-@B P`4Sp] fPP94 $S- 00$$ 4R 44S40SPSP 0SS 0C44S PP R= 4$R: 840S 840c41 B SPu! u4S (PC404lP0,4 (PC404pW*U0 P|0$,4St Z pp ;4 g0g44pt,$Z00R0Sw @-404$$(ē $\  $ 4g"0@0@"0@P@-@ t@40CSIGECA?=;0,44/P@P0/$0@ #0@@-@P00@-0SP0 8< 0/PP 0@s//N-MP0$ 00Mp`@ 0`)0000P0 P,0 P00PSQP1 3/PP) 0S`V* Vڄ00 R0C00P0  :0 000  1 3/PP  0T000@008P$Ѝ D- M@p pp  1 3/PP Cm a P0 0, 0  200 0 10p 1 3/PP&P 0SV`V*P0  :000(P 1 3/PP 800 0T000@008P Ѝ'-04M000000,0 (0, $0 1 3/4Ѝ0@-($M$4 0 1 @3/P$Ѝ00@-P 0+@L0M0|0Q.;#5"0 9000000 KPPP L000 L0,* R" 7 $4b0#02x0p 0 4"$t0p ##t#<x "<`".0\Pߍ"0@D0@0@?@x}-1u10@10@>0@@-0 M, 0X0 0P S000 00 1@3/P 0S000 Ѝ 00\0  00D01@01<011S001,0 0 /I0@`/@8^/@\/@8@-40@S%13/P8P1DP3/P8'pyP ,8 P00408810@/p@-HP`@ < 0S $@Tp@10@10@A90@<0@-0000 @?P,I0@p@-,0@0,0 7P4ePd0 001 (P%eP((p@0 ,00,0p20@20@430@8@-(@000 P eP- ,14,1PeP,;(1@14@1,0<,0,1808,1,1<0;0,1PePPPw8, ,10,1(1<(1 041820@20@10@30@30p@-nP@F0`1|0T1t01p0 Td0P (0X0`,0P0aP0H080D0<0p0(0p20@W/@h/@r/@HH0u0D-`(@s,03/P L0PZP[P  4/ 4/%| 4/h 4/'X 4/GD 4/40 4/$ 4/,03/P HN-0@h08? 0Y1@P L00 `1R00SCI0!@  a P03/0,3/0 3/0`V\0@ 3/ 0SP`   PP@ 0T@Ѝ0D-`M@ XPPp(P PEu   P @ 0T@Ѝ048 < ! /00R000/@-\ @<S<0@ 0  00S 0 0 0P00 0@-\0 @SZZPR00B 0 R   00 000000s@-8@P ,0^Go 0P|D-8@pP M_Go 0P 0101/@-0`P00 0=@PX  0<-:0> %B B0 T@P@P X 9Ѝp4N0@N-8@403/LPUX 3X /X +T0#` PL0XPH " Hp 0p<HPP P> 0@ 0A 0B 0PPPX H0Pmἲ弒,Hq`  0$0P0X400 0H0pSp@A 803/0Z0S@ C"0\X S\01D0S a P0M".(!&.0,!01 V P0, ">  PC @ C 0PP@C @ C 0PP0 Xp P Go <0HP0kPUЍ2Tv"3D )70@@-p`<@PY < SPP S/ D  0@xPH <0H0 0Lp0T000P000X00 0   0RxQ 00h08P 0`0,0X0$0T0(0 0D!0 ,, x F70@ċ/@X/@p/@/@ |/@/@@-00@ @| 00  @ A 000| 000 00   A  0/0  /0 // @-9耍[@- D`H Pp@-@ P`A p@0@8@-P@P8@- 0@0@0@0@@-@0@D@0@0  00 0  0 /F-@`pPS4TX/@`/@h/@p/@0000VPPT0P0U@0 5x 0Pd0`WP P&Y p 4 PK70@HH H Hv70@70@70@(80@@-@0(0 00 (0 Q 0 0 S0PQ:!", R > @<10000: (  0eN-P@E$,P @ @0 @@ZVZ` @( P@@DT 0##0pz'(pp p 0 p\:0  0!( V (  P  000-L80@F-@PE$,` @ @0 @@jfj@ P( `P0PPPPEU0 s'0(pMpy'(ppp y'8pp p\:0 f 0(  `  000-n80@A-@pP7Q& 1#(00 06(  06 (0000  Ra 0W 0AlA CR 00@0S/8@-0D P @R8`(\  0@, 0@-P {<@00 p`0P< p000! p0000000 0 #l` h00S\0000! 0`d 4N0@l t  $ (0 (>0@h0@-0SAP0P aQ@@  R ,00@@  4 R>0@D-XQXqT rLa H1@ @1P+E0P0 !@@;08#,#48#80@0000 @ 08#80 01AA0 #$48#8108#810PcH0PP@080< 8 @ X  \ < l  (4  D- 0P 8#xE 7 #,`#4 `08#,#40@00000@ 0`d M IX*<p*x%<%T'<'tᴡQqa P< l N-pQ@0Pp(A 1w@ P+a1p0@+ U@ 0P0 0c0 0P@c0@@ 0@@ J0``+ .@ 0Pu@`Ѝ4N0@@ X  \ d (4  0"S B0 BR0S "S00/@-0P 000C S0   4 @-@#0N-0#P0#0#@0#M0##    + tt#l#0rPPcPSPs D0000S "k 33222 T2/@D/@D/@/@/@/@D/@/@/@/@D/@/@20S|20S P20S| 0t P:p P Hl@8&1 T/@/@/@|/@/@/@/@/@!00!0 !1 %1 P 30S :x!0 0cS03/0S S S0 W AQ   1 0Ѝ( \  (  d D ')X (T ( t  0@l >0@0 >0@$ >0@p >0@*N0@>0@(N0@8 >0@>0@>0@;0@?0@-?0@K?0@$ k?0@x/@'8/@, @ |?0@ ?0@?0@0@E0@?0@@-@0@0 0@/RS*N-M@ p4P0`\W @ VI  0UPEQ!01000 0܍A0@0@-MM@ 2|00P0S 0SPUL0T 0T 00$0PЍۍ0`/8/\/@-0M h00P0S 0S0S @T,0 $ ۍ`/d/Tl0 @@ 0S (0T8  p@p(/7?0@T ?0@?0@h/?0@,L0@4/@0@l70//@1@- 1a0A0Q100S1! !4!0!i- :pP X@AP1P00@P,$! 0S 10S  0R 0@0 Q  0}00 0/ | j Ѝ@1h/p ,/l7z l/l )@0@7K@0@0/k?0@w@0@0 $ @0@h @0@@0@A0@E0@@0@/@8/@77(/(17@-Pt10@0CSJ/@/@/@/@/@/@<0P4(P 1P w0P0  lP@d;0008#,#48#80@<0<0@ <0<0`@@P0@H0H D00.>d 78 A0@A0@8L0@90@,N0@&A0@74A0@CA0@78(7\ @-000L S@0@4,000(00S@t70L0@.<0@?0@8L0@|/@7D-`2@0PQ20S " V SU0PE#$48#8S S Sp2 h2 @``r` XGP `@V:D3U0#DDH$H2T@ 1  11 !D |Q#tQp!0SS S00P1p!`00L!0L!081Q DAA01 R 1 1dp 0 0C## PE `;0 R`50U(y 0#$$("(v0#$48#80CStef h0 `^D=778.N0@VA0@77^A0@8pA0@8tA0@0L0@8L0@|/@E0@@ ?0@A0@A0@T A0@@-P  |2xPpB  Q*P4D2/ @b@2@00tA|`!t0S h10S 8!  0R @ 8A 0Q ! 10 0@ 00E 0 @0 c00@ A0, Ѝ@A0@,N0@A0@8L0@A0@z p 7l 82@0@7K@0@k?0@,B0@0 $ @0@h ZB0@@0@A0@E0@iB0@A0@4L0@|/@0L0@/@87777(.N0@@-|~B0@ Q/#:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/PTQ @-@A/Q0  aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/PQ @-@A/ 0R b0A1Q A1/ 0R bAQ0A/@-v0@pDHHHn,X` %@8Kp#0@.#0@A#0@Q#0@[#0@g#0@q#0@#0@ #(-27<FP'@B  !"#$%&'()*+,-./0123456789060@0 60@0@60@060@@ 60@@@60@@60@@60@D`H!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>ERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d gpio.c### ERROR ### Please RESET the board ### mkimage signature not found - ih_magic = %x Assuming u-boot.bin .. U-BootSPL: Un-supported Boot Device - %d!!! Unsupported OS image.. Jumping nevertheless.. U-Boot SPL %s (%s - %s) U-Boot 2011.09-00053-g967afe4Aug 16 201215:34:46Texas Instruments %s Revision detection unimplementedspl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %d spl: fat register err - %d u-boot.imgspl: error reading image %s, err - %d spl: wrong MMC boot mode spl: ymodem err - %s Loaded %d bytes autoloadyesNo Ethernet devices found Problem booting with BOOTP 00A100A2failed to read bmcr failed to write bmcr 1.0failed to read anar failed to write anar Auto Negotitation failed for port %d Could not probe the EEPROM; something fundamentally wrong on the I2C bus. Could not read the EEPROM; something fundamentally wrong on the I2C bus. Incorrect magic number in EEPROM read_eeprom() failure. continuing with ddr3 A335X_SKddr_vtt_enNo daughter card present Found a daughter card connected SKU#01SKU#02SKU#03A335BONEDid not find a recognized configuration, assuming General purpose EVM in Profile 0 with Daughter board tps65217_reg_write failure tps65217_voltage_update failure No AC power, disabling frequency switch spi_bus_noconsolettyO3,115200n8ethaddrCaution: Using hardcoded mac address. Set variable to overcome this. bootcmd=if mmc rescan; then echo SD/MMC found on device ${mmc_dev};if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;if run mmc_load_uimage_ext4; then run mmc_args;bootm ${kloadaddr};fi;fi;run nand_boot;bootdelay=1baudrate=115200autoload=yesbootfile=uImageloadaddr=0x82000000kloadaddr=0x80007fc0script_addr=0x81900000console=ttyO0,115200n8mmc_dev=0mmc_root=/dev/mmcblk0p2 ronand_root=ubi0:rootfs rw ubi.mtd=7,2048spi_root=/dev/mtdblock4 rwnor_root=/dev/mtdblock3 rwmmc_root_fs_type=ext4 rootwaitnand_root_fs_type=ubifs rootwait=1spi_root_fs_type=jffs2nor_root_fs_type=jffs2nand_src_addr=0x280000spi_src_addr=0x62000nor_src_addr=0x08080000nand_img_siz=0x500000spi_img_siz=0x380000nor_img_siz=0x280000spi_bus_no=0rootpath=/export/rootfsnfsopts=nolockstatic_ip=${ipaddr}:${serverip}:${gatewayip}:${netmask}:${hostname}::offip_method=nonebootenv=uEnv.txtloadbootenv=fatload mmc ${mmc_dev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizemmc_load_uimage=fatload mmc ${mmc_dev}:1 ${kloadaddr} ${bootfile}mmc_load_uimage_ext4=ext4load mmc ${mmc_dev}:2 ${kloadaddr} /boot/${bootfile}bootargs_defaults=setenv bootargs console=${console} ${optargs}mmc_args=run bootargs_defaults;setenv bootargs ${bootargs} root=${mmc_root} rootfstype=${mmc_root_fs_type} ip=${ip_method}nand_args=run bootargs_defaults;setenv bootargs ${bootargs} root=${nand_root} noinitrd rootfstype=${nand_root_fs_type} ip=${ip_method}spi_args=run bootargs_defaults;setenv bootargs ${bootargs} root=${spi_root} rootfstype=${spi_root_fs_type} ip=${ip_method}nor_args=run bootargs_defaults;setenv bootargs ${bootargs} root={nor_root} rootfstype=${nor_root_fs_type} ip=${ip_method}net_args=run bootargs_defaults;setenv bootargs ${bootargs} root=/dev/nfs nfsroot=${serverip}:${rootpath},${nfsopts} rw ip=dhcpmmc_boot=run mmc_args; run mmc_load_uimage_ext4; bootm ${kloadaddr}nand_boot=echo Booting from nand ...; run nand_args; nandecc hw 2; nand read.i ${kloadaddr} ${nand_src_addr} ${nand_img_siz}; bootm ${kloadaddr}spi_boot=echo Booting from spi ...; run spi_args; sf probe ${spi_bus_no}:0; sf read ${kloadaddr} ${spi_src_addr} ${spi_img_siz}; bootm ${kloadaddr}nor_boot=echo Booting from NOR ...; run nor_args; cp.b ${0x08080000} ${kloadaddr} ${nor_img_siz}; bootm ${kloadaddr}net_boot=echo Booting from network ...; setenv autoload no; dhcp; tftp ${kloadaddr} ${bootfile}; run net_args; bootm ${kloadaddr}Not implemented yet ## Warning: defaulting to text format ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zd = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed -f## Resetting to default environment %s=%s Environment size: %d/%ld bytes ## Error: "%s" not defined ## Error: illegal character '=' in variable name "%s" stdoutstderrCan't delete "%s" baudrate## Baudrate %d bps not supported ## Switch baudrate to %d bps and press ENTER ... ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d ipaddrloadaddrbootfilePlease enter '%s':setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXfilesizeenv_buf [%d bytes] too small for value of "%s" edit: environment handling commandsask name [message] [size] - ask for environment variable env default -f - reset default environment env edit name - edit environment variable env export [-t | -b | -c] addr [size] - export environment env import [-d] [-t | -b | -c] addr [size] - import environment env print [name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] editenvedit environment variablename - edit environment variable 'name'printenvprint environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name'set environment variablesname value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars) askenv name - get environment variable 'name' from stdin askenv name size - get environment variable 'name' from stdin (max 'size' chars) askenv name [message] size - display 'message' string and get environment variable 'name'from stdin (max 'size' chars)runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'defaultdeleteeditexportimportprintset%s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands *** Warning - %s, using default environment Using default environment env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedbootdelaybootcmdHit any key to stop autoboot: %2d %2d ** Too many args (max. %d) ** ## Command too long! Unknown command '%s' - try 'help' NULL device name! BUG: failure at %s:%d/%s()! miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %s: %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY reset timed out PHY extended status read failed, assuming no 1000BASE-X 1000BASE-X PHY AN duplexPHY 1000BT statusPHY duplex read failed, assuming half duplex PHY speedPHY AN speed read failed, assuming 10BASE-T serialCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access filebootcmd=if mmc rescan; then echo SD/MMC found on device ${mmc_dev};if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;if run mmc_load_uimage_ext4; then run mmc_args;bootm ${kloadaddr};fi;fi;run nand_boot;bootdelay=1baudrate=115200autoload=yesbootfile=uImageloadaddr=0x82000000kloadaddr=0x80007fc0script_addr=0x81900000console=ttyO0,115200n8mmc_dev=0mmc_root=/dev/mmcblk0p2 ronand_root=ubi0:rootfs rw ubi.mtd=7,2048spi_root=/dev/mtdblock4 rwnor_root=/dev/mtdblock3 rwmmc_root_fs_type=ext4 rootwaitnand_root_fs_type=ubifs rootwait=1spi_root_fs_type=jffs2nor_root_fs_type=jffs2nand_src_addr=0x280000spi_src_addr=0x62000nor_src_addr=0x08080000nand_img_siz=0x500000spi_img_siz=0x380000nor_img_siz=0x280000spi_bus_no=0rootpath=/export/rootfsnfsopts=nolockstatic_ip=${ipaddr}:${serverip}:${gatewayip}:${netmask}:${hostname}::offip_method=nonebootenv=uEnv.txtloadbootenv=fatload mmc ${mmc_dev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizemmc_load_uimage=fatload mmc ${mmc_dev}:1 ${kloadaddr} ${bootfile}mmc_load_uimage_ext4=ext4load mmc ${mmc_dev}:2 ${kloadaddr} /boot/${bootfile}bootargs_defaults=setenv bootargs console=${console} ${optargs}mmc_args=run bootargs_defaults;setenv bootargs ${bootargs} root=${mmc_root} rootfstype=${mmc_root_fs_type} ip=${ip_method}nand_args=run bootargs_defaults;setenv bootargs ${bootargs} root=${nand_root} noinitrd rootfstype=${nand_root_fs_type} ip=${ip_method}spi_args=run bootargs_defaults;setenv bootargs ${bootargs} root=${spi_root} rootfstype=${spi_root_fs_type} ip=${ip_method}nor_args=run bootargs_defaults;setenv bootargs ${bootargs} root={nor_root} rootfstype=${nor_root_fs_type} ip=${ip_method}net_args=run bootargs_defaults;setenv bootargs ${bootargs} root=/dev/nfs nfsroot=${serverip}:${rootpath},${nfsopts} rw ip=dhcpmmc_boot=run mmc_args; run mmc_load_uimage_ext4; bootm ${kloadaddr}nand_boot=echo Booting from nand ...; run nand_args; nandecc hw 2; nand read.i ${kloadaddr} ${nand_src_addr} ${nand_img_siz}; bootm ${kloadaddr}spi_boot=echo Booting from spi ...; run spi_args; sf probe ${spi_bus_no}:0; sf read ${kloadaddr} ${spi_src_addr} ${spi_img_siz}; bootm ${kloadaddr}nor_boot=echo Booting from NOR ...; run nor_args; cp.b ${0x08080000} ${kloadaddr} ${nor_img_siz}; bootm ${kloadaddr}net_boot=echo Booting from network ...; setenv autoload no; dhcp; tftp ${kloadaddr} ${bootfile}; run net_args; bootm ${kloadaddr}set_default_envmiiphy_register(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table mmc** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d ExtdFATFAT32%5d %10d %10d %2x%s 1 0 %10ld %2x Partition Start Sector Num Sectors Type Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%cCard did not respond to voltage select! %s: %d%c %s: timedout waiting for ics! %s: timedout waiting for cmddis! %s: timedout waiting for stat! %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_read_datammc_init_setupmmc_send_cmdmmc_init_streammmc_write_datammc_set_iosnand_base.cnand_do_write_ops: Device is write protected Timeout!nand_erase: attempt to erase a bad block at page 0x%08x %s: second ID read did not match %02x,%02x against %02x,%02x %s: unknown NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x (%s %s) NAND bus width %d instead %d bit No NAND device found!!! No oob scheme defined for oobsize %d No ECC functions supplied, Hardware ECC not possible %d byte HW ECC not possible on %d byte page size, fallback to SW ECC NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d Invalid ecc parameters NAND: Unable to find NAND settings in GPMC Configuration - quitting  failed. SF: Failed to set up slave SF: Unsupported manufacturer %02x SF: Detected %s with page size , total W25X40W25X16W25X32W25X64W25Q16W25Q32W25Q64W25Q128fullhalflink up on port %d, speed %d, %s duplex link down on port %d error %d submitting rx desc cpswSPI error: malloc of SPI structure failed SPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is %d Mhz SPI error: unsupported SPI mode %i SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x Invalid FAT entry FAT32 FAT12 FAT16 ** Can't read from device %d ** ** Partition %d not valid on device %d ** %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s %s %llu Bytes%s%lu.%ld %ciB%s%08lx: %0*x %s himport_r: can't insert "%s=%s" into hash table (null)%s:%u: %s: Assertion `%s' failed.EPTGMK(((((AAAAAABBBBBB0123456789abcdef0123456789ABCDEF*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathNIS Domain NameNFSBOOTP broadcast %d AM335x U-Boot SPL Retry count exceeded; starting again ethact%pM%s%daddr%saddreth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime, [PRIME] Warning: eth device name has a space! ethWarning: failed to set MAC address ethrotateunknownnetretryoncebad length %d < %d len bad %d < %d checksum bad ICMP Host Redirect to %pI4 ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again %d.%d.%d.%dnonegatewayipnetmaskserveripnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Using %s device Abort Bytes transferred = %ld (%lx hex) %lXfileaddr/T *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail /nfsroot/%02lX%02lX%02lX%02lX.img*** Warning: no boot file name; using '%s' File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize %lu MB received TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Not retrying... tftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP from server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx raise: Signal # %d caught  ` `  JJ  C0@$/@(/@HL0@N0@